For purchasing or obtaining a quotation, please visit the Distributor page
to find your local distributor.
HOME > Product search results > Code No. RN001P Anti-EIF4E pAb

Code No. RN001P

Anti-EIF4E pAb

Availability (in Japan)

10 or more

(In Japan at 17:00,
Apr 16, 2026 in JST)

Size

200 µL

Data
  • Western Blotting

  • Immunoprecipitation

  • RNP Immunoprecipitation

Clonality Polyclonal Clone Polyclonal
Isotype (Immunized Animal) Rabbit Ig (aff.)
Applications
WB
1:1,000  
IP
5 µL/250 µL of cell extract from 2.5 x 106 cells  
IC
Can be used.  
RIP
15 µL/500 µL of cell extract from 4.5 x 106 cells  
Immunogen (Antigen) KLH-conjugated synthetic peptide MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKH (1-37 a.a.)
Reactivity [Gene ID]

Human[1977](PMID: 22397984), Mouse[13684], Rat[117045], Hamster[100773768]

Storage buffer "200 µL volume of PBS containing 50% glycerol, pH 7.2"
Storage temp. -20°C Conjugate Unlabeled Manufacturer MBL
Alternative names "eukaryotic translation initiation factor 4E, CBP, EIF4E1, EIF4EL1/If4e, eIF-4E, EG668879, Eif4e-ps"
Background "The eukaryotic initiation factor 4E (eIF4E) is a key regulatory component that anchors the mRNA cap-binding complex (eIF4F) to the 5’ end of capped mRNAs. eIF3, the poly (A)-binding protein, and the eIF4 proteins recruit mRNA to the 43S initiation complex to form the 48S initiation complex. The eIF4 proteins consist of eIF4A; RNA helicase (46 kDa), eIF4B; RNA binding and RNA annealing protein (70 kDa), eIF4E (25 kDa); cap binding protein, eIF4H; work with eIF4B to stimulate eIF4A helicase activity (25 kDa), and eIF4G; co-localize all other proteins necessary for mRNA recruitment on the 40S subunit. As a principal initiation factor, eIF4E has the potential to influence expression of every protein in the cell. mRNA subset associated with eIF4E in p19 cell differed from mRNA subset associated with HuB or poly A binding protein, suggested that they reflect distinct functional subset of mRNAs whose expression is regulated differently at the level of translation."
Related products RN1001 RIP-Assay Kit
RN1005 RIP-Assay Kit for microRNA
RN002P Anti-eIF4G1 (Human) pAb
RN003P Anti-EIF4G2 pAb
RN004M Anti-Ribosomal P0/P1/P2 mAb
RN006M Anti-EIF4E mAb
RN048PW Anti-G3BP1 pAb
RN016M Anti-7-methylguanosine (m7G)-Cap mAb
RN017M Anti-7-methylguanosine (m7G) mAb
Citations

Western Blotting

  1. Fukao A et al. MicroRNAs Trigger Dissociation of eIF4AI and eIF4AII from Target mRNAs in Humans. Mol Cell 56, 79-89 (2014)(PMID:25280105)

RNP Immunoprecipitation

  1. Thompson K et al. Acute adaptive responses of central sensorimotor neurons after spinal cord injury. Translational Neuroscience 1, 268-78 (2010)
  2. Hayman TJ et al. Translation initiation factor eIF4E is a target for tumor cell radiosensitization. Cancer Res. 72, 2362-72 (2012)(PMID:22397984)
  3. Culjkovic-Kraljacic B et al. Combinatorial targeting of nuclear export and translation of RNA inhibits aggressive B-cell lymphomas. Blood 127, 858-68 (2016)(PMID:26603836)
  4. Rissland OS et al. The influence of microRNAs and poly(A) tail length on endogenous mRNA-protein complexes. Genome Biol. 18, 211 (2017)(PMID:29089021)
  5. Zahreddine HA et al. The eukaryotic translation initiation factor eIF4E harnesses hyaluronan production to drive its malignant activity. Elife. 6, e29830 (2017)(PMID:29111978)
Product category
Research area
RNA-RNP Network
Cancer
Brands
RiboCluster Profiler™
この製品に関するお問い合わせをする

  • The availability is based on the information in Japan at 17:00, Apr 16, 2026 in JST.
  • The special price is shown in red color.
  • Please note that products cannot be ordered from this website. To purchase the items listed in this website, please contact us or local distributers.
  • Abbreviations for applications:
    WB: Western Blotting, IH: Immunohistochemistry, IC: Immunocytochemistry, IP: Immunoprecipitation
    FCM: Flow Cytometry, NT: Neutralization, IF: Immunofluorescence, RIP: RNP Immunoprecipitation
    ChIP: Chromatin Immunoprecipitation, CoIP: Co-Immunoprecipitation
  • For applications and reactivity:
    *: The use is reported in a research article (Not tested by MBL). Please check the data sheet for detailed information.
    **: The use is reported from the licenser (Under evaluation or not tested by MBL).
  • For storage temparature: RT: room temparature
  • Please note that products in this website might be changed or discontinued without notification in advance for quality improvement.